What is the catalog number for MPPE1 Peptide - middle region?

The catalog number for MPPE1 Peptide - middle region is orb1999038.

What sizes are available for MPPE1 Peptide - middle region?

MPPE1 Peptide - middle region is available in the following size(s): 100 µg.

Is MPPE1 Peptide - middle region in stock?

MPPE1 Peptide - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

MPPE1 Peptide - middle region

Product Specifications

Product Name Alternative

PGAP5

UniProt

Q53F39

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001229833.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RLVLSGHTHSACEVHHGGRVPELSVPSFSWRNRNNPSFIMGSITPTDYTL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KN500740 1 Kit

Acox1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing

View Details

MBS1089629-01 0.02 mg (E-Coli)

Recombinant Corynebacterium urealyticum Mycothiol acetyltransferase (mshD)

Sign In for Pricing

View Details

MBS1089629-02 0.02 mg (Yeast)

Recombinant Corynebacterium urealyticum Mycothiol acetyltransferase (mshD)

Sign In for Pricing

View Details

MBS1089629-03 0.1 mg (E-Coli)

Recombinant Corynebacterium urealyticum Mycothiol acetyltransferase (mshD)

Sign In for Pricing

View Details

MBS1089629-04 0.1 mg (Yeast)

Recombinant Corynebacterium urealyticum Mycothiol acetyltransferase (mshD)

Sign In for Pricing

View Details

MBS1089629-05 0.02 mg (Baculovirus)

Recombinant Corynebacterium urealyticum Mycothiol acetyltransferase (mshD)

Sign In for Pricing

View Details