What is the catalog number for BAIAP2L2 Peptide - middle region?

The catalog number for BAIAP2L2 Peptide - middle region is orb1999035.

What sizes are available for BAIAP2L2 Peptide - middle region?

BAIAP2L2 Peptide - middle region is available in the following size(s): 100 µg.

Is BAIAP2L2 Peptide - middle region in stock?

BAIAP2L2 Peptide - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

BAIAP2L2 Peptide - middle region

Product Specifications

UniProt

Q6UXY1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_079321.3

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DMPPRPLGEFSSPRSRHGSGSYGTEPDARPASQLEPDRRSLPRTPSASSL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

E45R28960N 50 ul

NKX3.1 Rabbit pAb

Sign In for Pricing

View Details

H-3435.0005 5.0g

H-Gly-Gly-Leu-OH

Sign In for Pricing

View Details

sc-94093 10 µM

L-type Ca++ CP γ4 siRNA (h)

Sign In for Pricing

View Details

62127 1 PC

Dummy Cannula-Double/O.D.0.30mm/C.C1.4/Mates with M3.5

Sign In for Pricing

View Details

NBP3-06222DL594 0.1 mL

Rabbit Polyclonal UGT3A1 Antibody [DyLight 594]

Sign In for Pricing

View Details

HY-RS11948 1 Set

RHOBTB2 Human Pre-designed siRNA Set A

Sign In for Pricing

View Details