BAIAP2L2 Peptide - middle region
BAIAP2L2 Peptide - middle region
Product Specifications
UniProt
Q6UXY1
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_079321.3
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: DMPPRPLGEFSSPRSRHGSGSYGTEPDARPASQLEPDRRSLPRTPSASSL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
247556-FITC 100 µL
IL1F9 (Interleukin 1 Family, Member 9, IL-1F9, IL-1H1, IL-1RP2, IL1E, IL1H1, IL1RP2) (FITC)
Sign In for Pricing
View Details 
655077 40 pieces per CAR
FLUOTRAC600, Plate, 96w, F, 25-340μl/w, polystyrene, black, subpacked per 10 pieces, binding: HIGH, 40 pieces per CAR
Sign In for Pricing
View Details 