PPP4R1 Peptide - middle region
PPP4R1 Peptide - middle region
Product Specifications
Product Name Alternative
MEG1, PP4R1, PP4 (Rmeg)
UniProt
Q8TF05
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_001035847.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: EASGKPLGEISVPLDSSLLCTLSSESHQEAASNENDKKPGNYKSMLRPEV
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
RK-027-07 125 Tubes
Gastrin Releasing Peptide (GRP) (Human) - RIA Kit
Sign In for Pricing
View Details 
VAng-Cr6867-50gEcoli 50 µg (E. coli)
Recombinant Pasteurella Multocida hisA Protein (aa 1-249)
Sign In for Pricing
View Details 
GTR15296349 1 Vial
Lentiviral mouse Larp6 shRNA (UAS) - Lentiviral mouse Larp6 shRNA (UAS) (100)
Sign In for Pricing
View Details