PPP4R1 Peptide - middle region
PPP4R1 Peptide - middle region
Product Specifications
Product Name Alternative
MEG1, PP4R1, PP4 (Rmeg)
UniProt
Q8TF05
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_001035847.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: EASGKPLGEISVPLDSSLLCTLSSESHQEAASNENDKKPGNYKSMLRPEV
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS6288193-01 0.1 mL
CP045, ID (C16orf45, Uncharacterized protein C16orf45) (MaxLight 550)
Sign In for Pricing
View Details MBS6288193-02 5x 0.1 mL
CP045, ID (C16orf45, Uncharacterized protein C16orf45) (MaxLight 550)
Sign In for Pricing
View Details 
MBS6232961-01 0.1 mL
GABPA (GA-binding Protein alpha Chain, GABP Subunit alpha, Nuclear Respiratory Factor 2 Subunit alpha, Transcription Factor E4TF1-60, E4TF1A) (MaxLight 750)
Sign In for Pricing
View Details MBS6232961-02 5x 0.1 mL
GABPA (GA-binding Protein alpha Chain, GABP Subunit alpha, Nuclear Respiratory Factor 2 Subunit alpha, Transcription Factor E4TF1-60, E4TF1A) (MaxLight 750)
Sign In for Pricing
View Details