Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCT6B Peptide - middle region

CCT6B Peptide - middle region

Product Specifications

Product Name Alternative

Cctz2, CCTZ-2, TSA303, CCT-zeta-2, TCP-1-zeta-2

UniProt

Q92526

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001180458.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LVKAERKFIEDRVQKIIDLKDKVCAQSNKGFVVINQKGIDPFSLDSLAKH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-DDX17 Rabbit Monoclonal Antibody
MA2236-.1 100 µL

Anti-DDX17 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
THY1 Antibody (FITC)
orb357109-01 50 µg

THY1 Antibody (FITC)

Sign In for Pricing
View Details
THY1 Antibody (FITC)
orb357109-02 100 µg

THY1 Antibody (FITC)

Sign In for Pricing
View Details
Lentiviral human ST7L shRNA (UAS) - Lentiviral human ST7L shRNA (UAS, iRFP) (100)
GTR15311022 1 Vial

Lentiviral human ST7L shRNA (UAS) - Lentiviral human ST7L shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details
Anti-KBTBD4 Mouse Monoclonal Antibody [Clone ID: OTI2B6]
M17391 100 µL

Anti-KBTBD4 Mouse Monoclonal Antibody [Clone ID: OTI2B6]

Sign In for Pricing
View Details
Canine Mitochondrial import receptor subunit TOM34 (TOMM34) ELISA Kit
MBS7225760-01 48 Well

Canine Mitochondrial import receptor subunit TOM34 (TOMM34) ELISA Kit

Sign In for Pricing
View Details