Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCT6B Peptide - middle region

CCT6B Peptide - middle region

Product Specifications

Product Name Alternative

Cctz2, CCTZ-2, TSA303, CCT-zeta-2, TCP-1-zeta-2

UniProt

Q92526

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001180458.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LVKAERKFIEDRVQKIIDLKDKVCAQSNKGFVVINQKGIDPFSLDSLAKH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human CLIC5 Protein (His Tag)
MBS2580311-01 0.02 mg

Recombinant Human CLIC5 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human CLIC5 Protein (His Tag)
MBS2580311-02 0.1 mg

Recombinant Human CLIC5 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human CLIC5 Protein (His Tag)
MBS2580311-03 5x 0.1 mg

Recombinant Human CLIC5 Protein (His Tag)

Sign In for Pricing
View Details
OmniPAGE Mini - Casting Stand without base (no electrodes)
CVS10EXCASTER 1 Each

OmniPAGE Mini - Casting Stand without base (no electrodes)

Sign In for Pricing
View Details
WASF3 Peptide
orb2013908 100 µg

WASF3 Peptide

Sign In for Pricing
View Details
PTTG1IP siRNA (Mouse)
CRN0951-01 15 nmol

PTTG1IP siRNA (Mouse)

Sign In for Pricing
View Details