Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GTF2F1 Peptide - middle region

GTF2F1 Peptide - middle region

Product Specifications

Product Name Alternative

BTF4, RAP74, TF2F1, TFIIF

UniProt

P35269

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_002087.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LEDDLEMSSDASDASGEEGGRVPKAKKKAPLAKGGRKKKKKKGSDDEAFE

More Discoveries

Explore Other Products

Browse additional items from our catalog

C21orf121 Protein Vector (Human) (pPB-N-His)
PV006042 500 ng

C21orf121 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
Recombinant Burkholderia mallei GTP cyclohydrolase folE2 (folE2)
MBS1435082-01 0.02 mg (E-Coli)

Recombinant Burkholderia mallei GTP cyclohydrolase folE2 (folE2)

Sign In for Pricing
View Details
Recombinant Burkholderia mallei GTP cyclohydrolase folE2 (folE2)
MBS1435082-02 0.02 mg (Yeast)

Recombinant Burkholderia mallei GTP cyclohydrolase folE2 (folE2)

Sign In for Pricing
View Details
Recombinant Burkholderia mallei GTP cyclohydrolase folE2 (folE2)
MBS1435082-03 0.1 mg (E-Coli)

Recombinant Burkholderia mallei GTP cyclohydrolase folE2 (folE2)

Sign In for Pricing
View Details
Recombinant Burkholderia mallei GTP cyclohydrolase folE2 (folE2)
MBS1435082-04 0.1 mg (Yeast)

Recombinant Burkholderia mallei GTP cyclohydrolase folE2 (folE2)

Sign In for Pricing
View Details
Recombinant Burkholderia mallei GTP cyclohydrolase folE2 (folE2)
MBS1435082-05 0.02 mg (Baculovirus)

Recombinant Burkholderia mallei GTP cyclohydrolase folE2 (folE2)

Sign In for Pricing
View Details