What is the catalog number for GTF2F1 Peptide - middle region?

The catalog number for GTF2F1 Peptide - middle region is orb1999030.

What sizes are available for GTF2F1 Peptide - middle region?

GTF2F1 Peptide - middle region is available in the following size(s): 100 µg.

Is GTF2F1 Peptide - middle region in stock?

GTF2F1 Peptide - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

GTF2F1 Peptide - middle region

Product Specifications

Product Name Alternative

BTF4, RAP74, TF2F1, TFIIF

UniProt

P35269

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_002087.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LEDDLEMSSDASDASGEEGGRVPKAKKKAPLAKGGRKKKKKKGSDDEAFE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

A63583-050 50 µL

TMEM139 Polyclonal Antibody, Biotin Conjugated

Sign In for Pricing

View Details

RR208427L4 10 µg

Sumo3 (NM_001024295) Rat Tagged Lenti ORF Clone

Sign In for Pricing

View Details

SC207819 10 µg

RBM48 (NM_032120) Human 3' UTR Clone

Sign In for Pricing

View Details

MBS1148983-01 0.02 mg (E-Coli)

Recombinant Campylobacter concisus Glutamyl-tRNA (Gln) amidotransferase subunit A

Sign In for Pricing

View Details

MBS1148983-02 0.02 mg (Yeast)

Recombinant Campylobacter concisus Glutamyl-tRNA (Gln) amidotransferase subunit A

Sign In for Pricing

View Details

MBS1148983-03 0.1 mg (E-Coli)

Recombinant Campylobacter concisus Glutamyl-tRNA (Gln) amidotransferase subunit A

Sign In for Pricing

View Details