Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

POLR3C Peptide - middle region

POLR3C Peptide - middle region

Product Specifications

Product Name Alternative

RPC3, RPC62

UniProt

Q9BUI4

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001290385.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VPKLSLIGKGKRRRSSDEDAAGEPKAKRPKYTTDNKEPIPDDGIYWQANL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

5mL MacroTubes®
C2520 200 Units/Pack

5mL MacroTubes®

Sign In for Pricing
View Details
CHAC2 (NM_001008708) Human Recombinant Protein
TP305083 20 µg

CHAC2 (NM_001008708) Human Recombinant Protein

Sign In for Pricing
View Details
UNQ6493 (C-term) Rabbit Polyclonal Antibody
AP54470PU-N 400 µL

UNQ6493 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
XRCC1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2D8]
TA500886BM 100 µL

XRCC1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2D8]

Sign In for Pricing
View Details
Human IDO1 Recombinant Rabbit monoclonal Antibody
HA723154 100 µL

Human IDO1 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
CGRP (CALCB) Rabbit Polyclonal Antibody
TA364047 50 µL

CGRP (CALCB) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details