Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

POLR3C Peptide - middle region

POLR3C Peptide - middle region

Product Specifications

Product Name Alternative

RPC3, RPC62

UniProt

Q9BUI4

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001290385.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VPKLSLIGKGKRRRSSDEDAAGEPKAKRPKYTTDNKEPIPDDGIYWQANL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human LIF Protein (Fc Tag)
PKSH031990 100 µg

Recombinant Human LIF Protein (Fc Tag)

Sign In for Pricing
View Details
Frozen Tissue Sections, Kidney
CS628530 5x 5 µm

Frozen Tissue Sections, Kidney

Sign In for Pricing
View Details
1H,1H-Perfluorohexan-1-ol
TRC-P286350-5G 5 g

1H,1H-Perfluorohexan-1-ol

Sign In for Pricing
View Details
OR2AG1 (NM_001004489) Human Over-expression Lysate
LY423868 100 µg

OR2AG1 (NM_001004489) Human Over-expression Lysate

Sign In for Pricing
View Details
RELCH (NM_020854) Human Recombinant Protein
TP316688L 1 mg

RELCH (NM_020854) Human Recombinant Protein

Sign In for Pricing
View Details
Rat Elongation Of Very Long Chain Fatty Acids Like Protein 1 (ELOVL1) ELISA Kit
RDR-ELOVL1-Ra-01 96 Tests

Rat Elongation Of Very Long Chain Fatty Acids Like Protein 1 (ELOVL1) ELISA Kit

Sign In for Pricing
View Details