Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

QRICH1 Peptide - middle region

QRICH1 Peptide - middle region

Product Specifications

UniProt

Q2TAL8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_060200.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PPPSQQGSPREGERRVGTASVLQPVKKRKVDMPITVSYAISGQPVATVLA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AMACR / p504S (Prostate Cancer Marker) (rAMACR/1864), CF488A conjugate, 0.1mg/mL
BNC883175-500 1x 500 µL

AMACR / p504S (Prostate Cancer Marker) (rAMACR/1864), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Dinotefuran DN Hydrochloride
TRC-D484610-50MG 50 mg

Dinotefuran DN Hydrochloride

Sign In for Pricing
View Details
N-iso-Propyl-d7-acrylamide
TRC-I779124-2MG 2 mg

N-iso-Propyl-d7-acrylamide

Sign In for Pricing
View Details
Human SLC39A2 activation kit by CRISPRa
GA109359 1 Kit

Human SLC39A2 activation kit by CRISPRa

Sign In for Pricing
View Details
CF®505 Donkey Anti-Rabbit IgG (H+L), Highly Cross-Adsorbed, single label for STORM, 1 mg/mL
#20879-50uL 1x 50 µL

CF®505 Donkey Anti-Rabbit IgG (H+L), Highly Cross-Adsorbed, single label for STORM, 1 mg/mL

Sign In for Pricing
View Details
4-Ethyl-5-fluoropyrimidine Hydrochloride
TRC-E918000-25MG 25 mg

4-Ethyl-5-fluoropyrimidine Hydrochloride

Sign In for Pricing
View Details