SLC35A5 Peptide - C-terminal region
SLC35A5 Peptide - C-terminal region
Product Specifications
UniProt
Q9BS91
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_060415.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: VLLSIFIYNASKPQVPEYAPRQERIRDLSGNLWERSSGDGEELERLTKPK
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
037673-ML650 100 µL
LAMP3, NT (LAMP3, DCLAMP, TSC403, Lysosome-associated membrane glycoprotein 3, DC-lysosome-associated membrane glycoprotein, Protein TSC403, CD208) (MaxLight 650) discontinued
Sign In for Pricing
View Details 
bs-4433R-APC-Cy7 100 µL
PTRHD1 Polyclonal Antibody, APC-Cy7 Conjugated
Sign In for Pricing
View Details PA1939-Dylight488 100 µg
Anti-Cullin 3/CUL3 Antibody Picoband® (Dylight488 Conjugate)
Sign In for Pricing
View Details 
orb1605196 100 µL
Phospho-PI3 kinase p85 alpha + gamma (Tyr467 + Tyr199) Rabbit Polyclonal Antibody (APC-Cy7)
Sign In for Pricing
View Details