CCDC91 Peptide - middle region
CCDC91 Peptide - middle region
Product Specifications
Product Name Alternative
P56, HSD8
UniProt
Q7Z6B0
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_060788.3
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: EKGFLKEKEQEAISFQDRYKELQEKHKQELEDMRKAGHEALSIIVDEYKA
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS6253469-01 0.1 mL
CD1d (CD1d Antigen, CD1d Antigen D Polypeptide, R3, R3G1, Thymocyte Antigen CD1d) (MaxLight 490)
Sign In for Pricing
View Details MBS6253469-02 5x 0.1 mL
CD1d (CD1d Antigen, CD1d Antigen D Polypeptide, R3, R3G1, Thymocyte Antigen CD1d) (MaxLight 490)
Sign In for Pricing
View Details 
033712 200 µL
CDKN2B, NT (CDKN2B, MTS2, Cyclin-dependent kinase 4 inhibitor B, Multiple tumor suppressor 2, p14-INK4b, p15-INK4b)
Sign In for Pricing
View Details 