Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCDC91 Peptide - middle region

CCDC91 Peptide - middle region

Product Specifications

Product Name Alternative

P56, HSD8

UniProt

Q7Z6B0

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_060788.3

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EKGFLKEKEQEAISFQDRYKELQEKHKQELEDMRKAGHEALSIIVDEYKA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DNAJC4 Human shRNA Plasmid Kit (Locus ID 3338)
TL319762 1 Kit

DNAJC4 Human shRNA Plasmid Kit (Locus ID 3338)

Sign In for Pricing
View Details
Ebf3 Rabbit Polyclonal Antibody (Biotin)
orb2139783 100 µL

Ebf3 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
Cow Stress-Induced-Phosphoprotein 1 (STIP1) ELISA Kit
abx555790 96 Tests

Cow Stress-Induced-Phosphoprotein 1 (STIP1) ELISA Kit

Sign In for Pricing
View Details
Candida albicans (PE)
MBS6450342-01 0.1 mL

Candida albicans (PE)

Sign In for Pricing
View Details
Candida albicans (PE)
MBS6450342-02 5x 0.1 mL

Candida albicans (PE)

Sign In for Pricing
View Details
PDP1/PDP Rabbit Polyclonal Antibody (Carrier-free)
orb3103304 100 µg

PDP1/PDP Rabbit Polyclonal Antibody (Carrier-free)

Sign In for Pricing
View Details