Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SCYL3 Peptide - middle region

SCYL3 Peptide - middle region

Product Specifications

Product Name Alternative

PACE1, PACE-1

UniProt

Q8IZE3

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_065156.5

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: YYNTLLQTGDPFSQPIKFPINGLSDVKNTSEDSENFPSSSKKSEEWPDWS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD69 (NM_001781) Human Tagged ORF Clone
RC202756 10 µg

CD69 (NM_001781) Human Tagged ORF Clone

Sign In for Pricing
View Details
KCNQ3 Immunizing Peptide
MBS425804-01 0.1 mg

KCNQ3 Immunizing Peptide

Sign In for Pricing
View Details
KCNQ3 Immunizing Peptide
MBS425804-02 5x 0.1 mg

KCNQ3 Immunizing Peptide

Sign In for Pricing
View Details
Pcdhb9 Double Nickase Plasmid (m2)
sc-430071-NIC-2 20 µg

Pcdhb9 Double Nickase Plasmid (m2)

Sign In for Pricing
View Details
PNM6D rabbit pAb
UB-GEN-11766 100 µL

PNM6D rabbit pAb

Sign In for Pricing
View Details
Human DHPS shRNA Plasmid
abx951195-01 150 µg

Human DHPS shRNA Plasmid

Sign In for Pricing
View Details