What is the catalog number for MRPL46 Peptide - middle region?

The catalog number for MRPL46 Peptide - middle region is orb1999017.

What sizes are available for MRPL46 Peptide - middle region?

MRPL46 Peptide - middle region is available in the following size(s): 100 µg.

Is MRPL46 Peptide - middle region in stock?

MRPL46 Peptide - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

MRPL46 Peptide - middle region

Product Specifications

Product Name Alternative

LIECG2, P2ECSL, C15orf4

UniProt

Q9H2W6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_071446.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DLEDMWEQKFLQFKLGARITEADEKNDRTSLNRKLDRNLVLLVREKFGDQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

N001-660C-200UL 1x 200 µL

GFAP Recombinant Alpaca VHH (SdAb2409.GFAP), CF®660C Conjugate, MiniMabTM

Sign In for Pricing

View Details

orb348865 0.2 mg

Anti-IL-2R alpha (CD25) [Basiliximab]

Sign In for Pricing

View Details

LY409438 100 µg

RCSD 1 (RCSD1) (NM_052862) Human Over-expression Lysate

Sign In for Pricing

View Details

25380091 4x 500 ng

KCNJ16-set siRNA/shRNA/RNAi Lentivector (Human)

Sign In for Pricing

View Details

GTR10478986-01 48 Well

Guinea pig Low affinity immunoglobulin gamma Fc region receptor II a ELISA Kit

Sign In for Pricing

View Details

GTR10478986-02 96 Well

Guinea pig Low affinity immunoglobulin gamma Fc region receptor II a ELISA Kit

Sign In for Pricing

View Details