What is the catalog number for MRPL46 Peptide - middle region?

The catalog number for MRPL46 Peptide - middle region is orb1999017.

What sizes are available for MRPL46 Peptide - middle region?

MRPL46 Peptide - middle region is available in the following size(s): 100 µg.

Is MRPL46 Peptide - middle region in stock?

MRPL46 Peptide - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

MRPL46 Peptide - middle region

Product Specifications

Product Name Alternative

LIECG2, P2ECSL, C15orf4

UniProt

Q9H2W6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_071446.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DLEDMWEQKFLQFKLGARITEADEKNDRTSLNRKLDRNLVLLVREKFGDQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

sc-149798-PR 10 µM - 20 µL

NAG-2 (m) -PR

Sign In for Pricing

View Details

M05318-1 100 µL

Anti-SNAP29 Antibody (Monoclonal, 32S30)

Sign In for Pricing

View Details

NBP3-24265AF532 0.1 mL

Mouse Monoclonal INSM1 Antibody (rINSM1/6287) [Alexa Fluor 532]

Sign In for Pricing

View Details

SB-JOT0009-1-100 100 (25 x 4)

anti-EGFR VHH antibody

Sign In for Pricing

View Details

15080014 1.0 µg DNA

Casq1 ORF Vector (Mouse) (pORF)

Sign In for Pricing

View Details

sc-398292 AF594 200 µg/mL

BRUNOL4 (C-4) Alexa Fluor® 594

Sign In for Pricing

View Details