Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

COPS7B Peptide - middle region

COPS7B Peptide - middle region

Product Specifications

Product Name Alternative

CSN7B, SGN7b

UniProt

Q9H9Q2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001269879.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GIEQQVLRANQYKENHNRTQQQVEAEVTNIKKTLKATASSSAQEMEQQLA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

WISP2 Rabbit Polyclonal Antibody (PE-Cy7)
orb971349 100 µL

WISP2 Rabbit Polyclonal Antibody (PE-Cy7)

Sign In for Pricing
View Details
Deflazacort-d7
HY-13609S1 1 mg

Deflazacort-d7

Sign In for Pricing
View Details
KCNQ3 Antibody
orb1249538 0.1 mg

KCNQ3 Antibody

Sign In for Pricing
View Details
Canine RecQ-mediated genome instability protein 1 (RMI1) ELISA Kit
MBS7202858-01 48 Well

Canine RecQ-mediated genome instability protein 1 (RMI1) ELISA Kit

Sign In for Pricing
View Details
Canine RecQ-mediated genome instability protein 1 (RMI1) ELISA Kit
MBS7202858-02 96 Well

Canine RecQ-mediated genome instability protein 1 (RMI1) ELISA Kit

Sign In for Pricing
View Details
Canine RecQ-mediated genome instability protein 1 (RMI1) ELISA Kit
MBS7202858-03 5x 96 Well

Canine RecQ-mediated genome instability protein 1 (RMI1) ELISA Kit

Sign In for Pricing
View Details