Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

COPS7B Peptide - middle region

COPS7B Peptide - middle region

Product Specifications

Product Name Alternative

CSN7B, SGN7b

UniProt

Q9H9Q2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001269879.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GIEQQVLRANQYKENHNRTQQQVEAEVTNIKKTLKATASSSAQEMEQQLA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FRAT1, ID (Proto-oncogene FRAT1, Frequently Rearranged in Advanced T-cell Lymphomas, Frat-1) (Biotin) discontinued
F6090-01A-Biotin 200 µL

FRAT1, ID (Proto-oncogene FRAT1, Frequently Rearranged in Advanced T-cell Lymphomas, Frat-1) (Biotin) discontinued

Sign In for Pricing
View Details
HAO2 Protein Vector (Mouse) (pPM-C-HA)
PV187876 500 ng

HAO2 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
Anti-Zebrafish P53/TP53 Antibody Picoband® HRP Conjugated
AZP79734-HRP 100 µg/Vial

Anti-Zebrafish P53/TP53 Antibody Picoband® HRP Conjugated

Sign In for Pricing
View Details
Anti-Human CD11a/ITGAL Antibody (SAA1403), FITC
MBS1583630-01 50 Tests

Anti-Human CD11a/ITGAL Antibody (SAA1403), FITC

Sign In for Pricing
View Details
Anti-Human CD11a/ITGAL Antibody (SAA1403), FITC
MBS1583630-02 100 Tests

Anti-Human CD11a/ITGAL Antibody (SAA1403), FITC

Sign In for Pricing
View Details
Anti-Human CD11a/ITGAL Antibody (SAA1403), FITC
MBS1583630-03 5x 100 Tests

Anti-Human CD11a/ITGAL Antibody (SAA1403), FITC

Sign In for Pricing
View Details