Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

THG1L Peptide - middle region

THG1L Peptide - middle region

Product Specifications

Product Name Alternative

ICF45, IHG-1, hTHG1

UniProt

Q9NWX6

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_060342.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DGRVVVYPSNQTLKDYLSWRQADCHINNLYNTVFWALIQQSGLTPVQAQG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Angiopoietin 1 Antibody
AF5184-01 100 µL

Angiopoietin 1 Antibody

Sign In for Pricing
View Details
Angiopoietin 1 Antibody
AF5184-02 200 µL

Angiopoietin 1 Antibody

Sign In for Pricing
View Details
RpS21 Antibody
orb807314 2 mg

RpS21 Antibody

Sign In for Pricing
View Details
Mouse anti Human IgM
MBS530736-01 1 mg

Mouse anti Human IgM

Sign In for Pricing
View Details
Mouse anti Human IgM
MBS530736-02 5x 1 mg

Mouse anti Human IgM

Sign In for Pricing
View Details
YMEL1, NT (YME1L1, FTSH1, YME1L, ATP-dependent zinc metalloprotease YME1L1, ATP-dependent metalloprotease FtsH1, Meg-4, Presenilin-associated metalloprotease, YME1-like protein 1) (FITC) discontinued
043961-FITC 200 µL

YMEL1, NT (YME1L1, FTSH1, YME1L, ATP-dependent zinc metalloprotease YME1L1, ATP-dependent metalloprotease FtsH1, Meg-4, Presenilin-associated metalloprotease, YME1-like protein 1) (FITC) discontinued

Sign In for Pricing
View Details