What is the catalog number for THG1L Peptide - middle region?

The catalog number for THG1L Peptide - middle region is orb1999015.

What sizes are available for THG1L Peptide - middle region?

THG1L Peptide - middle region is available in the following size(s): 100 µg.

Is THG1L Peptide - middle region in stock?

THG1L Peptide - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

THG1L Peptide - middle region

Product Specifications

Product Name Alternative

ICF45, IHG-1, hTHG1

UniProt

Q9NWX6

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_060342.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DGRVVVYPSNQTLKDYLSWRQADCHINNLYNTVFWALIQQSGLTPVQAQG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NBP2-34537AF405 0.1 mL

Mouse Monoclonal CD6 Antibody (3F7B5) [Alexa Fluor 405]

Sign In for Pricing

View Details

27380026 500 ng

LOC682102 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing

View Details

K0015701 3x 1.0 µg

AARS2 sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing

View Details

516897 1 g

MPEG7-Br

Sign In for Pricing

View Details

TRV-0003333-01 20 µL

Polyclonal Antibody to Stathmin 1 (STMN1)

Sign In for Pricing

View Details

TRV-0003333-02 100 µL

Polyclonal Antibody to Stathmin 1 (STMN1)

Sign In for Pricing

View Details