Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

THG1L Peptide - middle region

THG1L Peptide - middle region

Product Specifications

Product Name Alternative

ICF45, IHG-1, hTHG1

UniProt

Q9NWX6

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_060342.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DGRVVVYPSNQTLKDYLSWRQADCHINNLYNTVFWALIQQSGLTPVQAQG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cortactin phospho-Tyr421 Rabbit Polyclonal Antibody
E53P01534 100 µL

Cortactin phospho-Tyr421 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Anti-CD164 Antibody (PE), Mouse Monoclonal
MBS8106331-01 25 Tests

Anti-CD164 Antibody (PE), Mouse Monoclonal

Sign In for Pricing
View Details
Anti-CD164 Antibody (PE), Mouse Monoclonal
MBS8106331-02 100 Tests

Anti-CD164 Antibody (PE), Mouse Monoclonal

Sign In for Pricing
View Details
Anti-CD164 Antibody (PE), Mouse Monoclonal
MBS8106331-03 5x 100 Tests

Anti-CD164 Antibody (PE), Mouse Monoclonal

Sign In for Pricing
View Details
TMPRSS3 Antibody
E19-8730-2 100 µg -100 µL

TMPRSS3 Antibody

Sign In for Pricing
View Details
Human CCDC39 Pre-designed siRNA Set B
SI002372B 1 Each

Human CCDC39 Pre-designed siRNA Set B

Sign In for Pricing
View Details