What is the catalog number for KIAA0930 Peptide - middle region?

The catalog number for KIAA0930 Peptide - middle region is orb1999014.

What sizes are available for KIAA0930 Peptide - middle region?

KIAA0930 Peptide - middle region is available in the following size(s): 100 µg.

Is KIAA0930 Peptide - middle region in stock?

KIAA0930 Peptide - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

KIAA0930 Peptide - middle region

Product Specifications

Product Name Alternative

LSC3, C22orf9

UniProt

Q6ICG6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001009880.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: HKKKSQQVFASPSKHPMDSKGEESKISYPNIFFMIDSFEEVFSDMTVGEG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NBP1-77370B 0.1 mL

Rabbit Polyclonal SRPX2 Antibody [Biotin]

Sign In for Pricing

View Details

PCP55-30192-01 20 Tests

PerCP-Cy5.5 Anti-Human CD2 Antibody (TS1/8)

Sign In for Pricing

View Details

PCP55-30192-02 100 Tests

PerCP-Cy5.5 Anti-Human CD2 Antibody (TS1/8)

Sign In for Pricing

View Details

orb1588898 100 µL

CD19 Rabbit Polyclonal Antibody (BF647)

Sign In for Pricing

View Details

FAB2408P-025 25 Tests

Human NCAM-1/CD56 Phycoerythrin MAb (Clone 301040)

Sign In for Pricing

View Details

ICH5276-1mg 1 mg

Sirexatamab Biosimilar - Research Grade

Sign In for Pricing

View Details