What is the catalog number for KIAA0930 Peptide - middle region?

The catalog number for KIAA0930 Peptide - middle region is orb1999014.

What sizes are available for KIAA0930 Peptide - middle region?

KIAA0930 Peptide - middle region is available in the following size(s): 100 µg.

Is KIAA0930 Peptide - middle region in stock?

KIAA0930 Peptide - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

KIAA0930 Peptide - middle region

Product Specifications

Product Name Alternative

LSC3, C22orf9

UniProt

Q6ICG6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001009880.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: HKKKSQQVFASPSKHPMDSKGEESKISYPNIFFMIDSFEEVFSDMTVGEG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

13557111 3x 1.0 µg

BTG4 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing

View Details

TA806790BM 100 µL

Dishevelled 2 (DVL2) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1E11]

Sign In for Pricing

View Details

NSL0339Bo 96 Tests

Bovine Glutathione (GSH) ELISA Kit

Sign In for Pricing

View Details

34036-05141 2x 75 µg

Human OAT AssayLite™ Antibody (FITC Conjugae)

Sign In for Pricing

View Details

NBP3-08708MFV610 0.1 mL

Mouse Monoclonal Annexin A1 Antibody (ANXA1/3566) [mFluor Violet 610 SE]

Sign In for Pricing

View Details

NBP3-30983-250ug 250 µg

Sheep Polyclonal VAMP-2 Antibody

Sign In for Pricing

View Details