KIAA0930 Peptide - middle region
KIAA0930 Peptide - middle region
Product Specifications
Product Name Alternative
LSC3, C22orf9
UniProt
Q6ICG6
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_001009880.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: HKKKSQQVFASPSKHPMDSKGEESKISYPNIFFMIDSFEEVFSDMTVGEG
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
47178124 3x 1.0µg DNA
TMTC3 CRISPRa sgRNA lentivector (set of three targets)(Mouse)
Sign In for Pricing
View Details 
MBS1436310 Inquire
Recombinant Aspergillus oryzae Probable beta-mannosidase B (mndB)
Sign In for Pricing
View Details GTR15276051 1 Vial
Lentiviral mouse Krtap14 shRNA (UAS) - Lentiviral mouse Krtap14 shRNA (UAS, iRFP) (100)
Sign In for Pricing
View Details 