Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KIAA0930 Peptide - middle region

KIAA0930 Peptide - middle region

Product Specifications

Product Name Alternative

LSC3, C22orf9

UniProt

Q6ICG6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001009880.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: HKKKSQQVFASPSKHPMDSKGEESKISYPNIFFMIDSFEEVFSDMTVGEG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FXYD6 (NM_022003) Human Recombinant Protein
PH37188M5 20 µg

FXYD6 (NM_022003) Human Recombinant Protein

Sign In for Pricing
View Details
ANO10 Knockout Hela Polyclonal Cells
ARG20837 1 Million

ANO10 Knockout Hela Polyclonal Cells

Sign In for Pricing
View Details
Dengue NS1 ST4, Insect
PT-A01352-01 2 µg

Dengue NS1 ST4, Insect

Sign In for Pricing
View Details
Dengue NS1 ST4, Insect
PT-A01352-02 10 µg

Dengue NS1 ST4, Insect

Sign In for Pricing
View Details
Dengue NS1 ST4, Insect
PT-A01352-03 1 mg

Dengue NS1 ST4, Insect

Sign In for Pricing
View Details
Dipeptidyl Peptidase IV (DPP4) Assay Kit
abx295082 96 Tests

Dipeptidyl Peptidase IV (DPP4) Assay Kit

Sign In for Pricing
View Details