Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OXSM Peptide - middle region

OXSM Peptide - middle region

Product Specifications

Product Name Alternative

KS, KASI, FASN2D

UniProt

Q9NWU1

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001138863.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VSLVGEEYKSIPCSVAAYVPRGSDEGQFNEQNFVSKSDIKSMSSPTIMAI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NFKB1 pSer932 Rabbit Polyclonal Antibody
AP02503PU-S 50 µL

NFKB1 pSer932 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
HSP27 (Heat Shock Protein 27) (rHSPB1/774), CF594 conjugate, 0.1mg/mL
BNC942308-500 1x 500 µL

HSP27 (Heat Shock Protein 27) (rHSPB1/774), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mouse Mgat4e activation kit by CRISPRa
GA208696 1 Kit

Mouse Mgat4e activation kit by CRISPRa

Sign In for Pricing
View Details
CALY Polyclonal Antibody
E-AB-90190-01 60 µL

CALY Polyclonal Antibody

Sign In for Pricing
View Details
CALY Polyclonal Antibody
E-AB-90190-02 120 µL

CALY Polyclonal Antibody

Sign In for Pricing
View Details
CALY Polyclonal Antibody
E-AB-90190-03 200 µL

CALY Polyclonal Antibody

Sign In for Pricing
View Details