What is the catalog number for DCUN1D4 Peptide - middle region?

The catalog number for DCUN1D4 Peptide - middle region is orb1999012.

What sizes are available for DCUN1D4 Peptide - middle region?

DCUN1D4 Peptide - middle region is available in the following size(s): 100 µg.

Is DCUN1D4 Peptide - middle region in stock?

DCUN1D4 Peptide - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

DCUN1D4 Peptide - middle region

Product Specifications

UniProt

Q92564

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001035492.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: NLTEDIGQDDHQTGSLRSCSSSDCFNKVMPPRKKRRPASGDDLSAKKSRH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

orb941999 100 µL

NeuN Rabbit Polyclonal Antibody (PE-Cy7)

Sign In for Pricing

View Details

MBS7167198 Inquire

Rabbit anti-Escherichia coli O1:K1/APEC QUEC Polyclonal Antibody

Sign In for Pricing

View Details

HRF-S367-1mg 1 mg

Monoclonal Anti-HRSV F Antibody, Human IgG1 (AM14) (MALS verified)

Sign In for Pricing

View Details

abx002743-01 60 µL

Chloride Channel Protein ClC-Ka (CLCNKA) Antibody

Sign In for Pricing

View Details

abx002743-02 120 µL

Chloride Channel Protein ClC-Ka (CLCNKA) Antibody

Sign In for Pricing

View Details

abx002743-03 200 µL

Chloride Channel Protein ClC-Ka (CLCNKA) Antibody

Sign In for Pricing

View Details