What is the catalog number for QRSL1 Peptide - middle region?

The catalog number for QRSL1 Peptide - middle region is orb1999011.

What sizes are available for QRSL1 Peptide - middle region?

QRSL1 Peptide - middle region is available in the following size(s): 100 µg.

Is QRSL1 Peptide - middle region in stock?

QRSL1 Peptide - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

QRSL1 Peptide - middle region

Product Specifications

Product Name Alternative

GatA

UniProt

Q9H0R6

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_060762.3

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: YSKQYREKRKQNPHSENEDSDWLITGGSSGGSAAAVSAFTCYAALGSDTG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

E45R08031G-1 100 µL

IRGM Antibody (C-term)

Sign In for Pricing

View Details

Z03501-100 100 µg

SARS-CoV-2 Spike protein (S1)

Sign In for Pricing

View Details

MBS1058754-01 0.05 mg (E-Coli)

Recombinant Chlorobaculum parvum Acetylglutamate kinase (argB)

Sign In for Pricing

View Details

MBS1058754-02 0.05 mg (Yeast)

Recombinant Chlorobaculum parvum Acetylglutamate kinase (argB)

Sign In for Pricing

View Details

MBS1058754-03 0.2 mg (E-Coli)

Recombinant Chlorobaculum parvum Acetylglutamate kinase (argB)

Sign In for Pricing

View Details

MBS1058754-04 0.05 mg (Baculovirus)

Recombinant Chlorobaculum parvum Acetylglutamate kinase (argB)

Sign In for Pricing

View Details