QRSL1 Peptide - middle region
QRSL1 Peptide - middle region
Product Specifications
Product Name Alternative
GatA
UniProt
Q9H0R6
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_060762.3
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: YSKQYREKRKQNPHSENEDSDWLITGGSSGGSAAAVSAFTCYAALGSDTG
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS6398857-01 0.1 mL
YARS2 (Tyrosine--tRNA Ligase, Mitochondrial, CGI-04, Tyrosyl-tRNA Synthetase, TyrRS) (FITC)
Sign In for Pricing
View Details MBS6398857-02 5x 0.1 mL
YARS2 (Tyrosine--tRNA Ligase, Mitochondrial, CGI-04, Tyrosyl-tRNA Synthetase, TyrRS) (FITC)
Sign In for Pricing
View Details 
MBS2700349-01 24 Strip Well
Rat Thyrotropin Releasing Hormone (TRH) ELISA Kit
Sign In for Pricing
View Details MBS2700349-02 48 Well
Rat Thyrotropin Releasing Hormone (TRH) ELISA Kit
Sign In for Pricing
View Details