Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DUS1L Peptide - middle region

DUS1L Peptide - middle region

Product Specifications

Product Name Alternative

DUS1, PP3111

UniProt

Q6P1R4

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_071439.3

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: CQPYIRPGPREGSKEKAGARSKRALEEEEGGTEVLSKNKQKKQLRNPHKT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant CEACAM6 Monoclonal Antibody
AN302030L-01 50 µL

Recombinant CEACAM6 Monoclonal Antibody

Sign In for Pricing
View Details
Recombinant CEACAM6 Monoclonal Antibody
AN302030L-02 100 µL

Recombinant CEACAM6 Monoclonal Antibody

Sign In for Pricing
View Details
PWP1 Human Knockdown Lysate
LY300411 100 µg

PWP1 Human Knockdown Lysate

Sign In for Pricing
View Details
Ago1 Mouse Gene Knockout Kit (CRISPR)
KN500981 1 Kit

Ago1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
P63 (Squamous, Basal & Myoepithelial Cell Marker) (TP63/2428), CF740 conjugate, 0.1mg/mL
BNC742428-100 1x 100 µL

P63 (Squamous, Basal & Myoepithelial Cell Marker) (TP63/2428), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tissue Total RNA, Myometrium
CR560363 5 µg

Tissue Total RNA, Myometrium

Sign In for Pricing
View Details