Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DUS1L Peptide - middle region

DUS1L Peptide - middle region

Product Specifications

Product Name Alternative

DUS1, PP3111

UniProt

Q6P1R4

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_071439.3

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: CQPYIRPGPREGSKEKAGARSKRALEEEEGGTEVLSKNKQKKQLRNPHKT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GREM1 Antibody
KC-3795-01 50 μL

GREM1 Antibody

Sign In for Pricing
View Details
GREM1 Antibody
KC-3795-02 100 µL

GREM1 Antibody

Sign In for Pricing
View Details
GREM1 Antibody
KC-3795-03 1 mL

GREM1 Antibody

Sign In for Pricing
View Details
FITC Anti-Mouse/Rat Foxp3 Antibody[FJK-16s]
E-AB-F1351C-01 50 Tests

FITC Anti-Mouse/Rat Foxp3 Antibody[FJK-16s]

Sign In for Pricing
View Details
FITC Anti-Mouse/Rat Foxp3 Antibody[FJK-16s]
E-AB-F1351C-02 100 Tests

FITC Anti-Mouse/Rat Foxp3 Antibody[FJK-16s]

Sign In for Pricing
View Details
FITC Anti-Mouse/Rat Foxp3 Antibody[FJK-16s]
E-AB-F1351C-03 2x 100 Tests

FITC Anti-Mouse/Rat Foxp3 Antibody[FJK-16s]

Sign In for Pricing
View Details