Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UBXN6 Peptide - N-terminal region

UBXN6 Peptide - N-terminal region

Product Specifications

Product Name Alternative

UBXD1, UBXDC2

UniProt

Q9BZV1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001164562.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EFKADIKFKSAGPGQKLKESVGEKAHKEKPNQPAPRPPRQGPTNEAQMAA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MIR6719 Human qPCR Primer Pair (MI0022554)
HP301317 200 Reactions

MIR6719 Human qPCR Primer Pair (MI0022554)

Sign In for Pricing
View Details
Uncoated Human BAFF/CD257 (B-Cell Activating Factor) ELISA Kit
E-UNEL-H0242-01 5x 96 Tests

Uncoated Human BAFF/CD257 (B-Cell Activating Factor) ELISA Kit

Sign In for Pricing
View Details
Uncoated Human BAFF/CD257 (B-Cell Activating Factor) ELISA Kit
E-UNEL-H0242-02 15x 96 Tests

Uncoated Human BAFF/CD257 (B-Cell Activating Factor) ELISA Kit

Sign In for Pricing
View Details
Protein A/G PCR Plates - semi skirted
PCR960208-PA/G 10 Plates

Protein A/G PCR Plates - semi skirted

Sign In for Pricing
View Details
Tissue FFPE Sections, Endometriotic tissue
CS703695 5x 5 µm

Tissue FFPE Sections, Endometriotic tissue

Sign In for Pricing
View Details
Human LRIG3 activation kit by CRISPRa
GA114737 1 Kit

Human LRIG3 activation kit by CRISPRa

Sign In for Pricing
View Details