Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UBXN6 Peptide - N-terminal region

UBXN6 Peptide - N-terminal region

Product Specifications

Product Name Alternative

UBXD1, UBXDC2

UniProt

Q9BZV1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001164562.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EFKADIKFKSAGPGQKLKESVGEKAHKEKPNQPAPRPPRQGPTNEAQMAA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NFKB1 Rabbit Polyclonal Antibody
AP02560PU-N 100 µL

NFKB1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
AP3D1 Human Gene Knockout Kit (CRISPR)
KN419366 1 Kit

AP3D1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Anti Human CARD14 Polyclonal
Y054517 100 µL

Anti Human CARD14 Polyclonal

Sign In for Pricing
View Details
ExoBriteTM R-PE IgG1 Isotype Control Flow Antibody (25 tests)
P008-RPE-125 1x 125 µL

ExoBriteTM R-PE IgG1 Isotype Control Flow Antibody (25 tests)

Sign In for Pricing
View Details
WNT5B (NM_030775) Human Over-expression Lysate
LC403078 20 µg

WNT5B (NM_030775) Human Over-expression Lysate

Sign In for Pricing
View Details
Bcl-6 (Follicular Lymphoma Marker) (rBCL6/1475), CF568 conjugate, 0.1mg/mL
BNC683433-100 1x 100 µL

Bcl-6 (Follicular Lymphoma Marker) (rBCL6/1475), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details