Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DCUN1D4 Peptide - middle region

DCUN1D4 Peptide - middle region

Product Specifications

UniProt

Q92564

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001035492.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KRRPASGDDLSAKKSRHDSMYRKYDSTRIKTEEEAFSSKRCLEWFYEYAG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EED Antibody
KC-1044-01 50 μL

EED Antibody

Sign In for Pricing
View Details
EED Antibody
KC-1044-02 100 µL

EED Antibody

Sign In for Pricing
View Details
EED Antibody
KC-1044-03 1 mL

EED Antibody

Sign In for Pricing
View Details
Tissue FFPE Sections, Joint
CS714910 5x 5 µm

Tissue FFPE Sections, Joint

Sign In for Pricing
View Details
Human FBXL22 activation kit by CRISPRa
GA117060 1 Kit

Human FBXL22 activation kit by CRISPRa

Sign In for Pricing
View Details
Dibutyl 3,3'-azanediyldipropionate Hydrochloride
TRC-D224955-250MG 250 mg

Dibutyl 3,3'-azanediyldipropionate Hydrochloride

Sign In for Pricing
View Details