Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DCUN1D4 Peptide - middle region

DCUN1D4 Peptide - middle region

Product Specifications

UniProt

Q92564

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001035492.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KRRPASGDDLSAKKSRHDSMYRKYDSTRIKTEEEAFSSKRCLEWFYEYAG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Kappa Light Chain Mouse Monoclonal Antibody [Clone ID: L1C1]
AM33125PU-T 20 µg

Human Kappa Light Chain Mouse Monoclonal Antibody [Clone ID: L1C1]

Sign In for Pricing
View Details
Tissue Protein Lysate, Stomach
CP565507 150 µg

Tissue Protein Lysate, Stomach

Sign In for Pricing
View Details
Stx7 Mouse Gene Knockout Kit (CRISPR)
KN516934 1 Kit

Stx7 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human IgM (Immunoglobulin Mu Heavy Chain) (B-Cell Marker) (IGHM/2559R), CF405S conjugate, 0.1mg/mL
BNC042559-100 1x 100 µL

Human IgM (Immunoglobulin Mu Heavy Chain) (B-Cell Marker) (IGHM/2559R), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Progesterone Receptor (PR484), CF488A conjugate, 0.1mg/mL
BNC880484-100 1x 100 µL

Progesterone Receptor (PR484), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45RO (T200/797), CF488A conjugate, 0.1mg/mL
BNC880797-100 1x 100 µL

CD45RO (T200/797), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details