Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCSER2 Peptide - middle region

CCSER2 Peptide - middle region

Product Specifications

Product Name Alternative

Gcap14, FAM190B, KIAA1128, bA486O22.1

UniProt

Q9H7U1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001271169.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RYLSDDVDDISLSSLSSSDKNDLSEDFSDDFIDIEDSNRTRITPEEMSLK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Calprotectin / MRP14 / S100A9 / Calgranulin B (rMAC3781), CF568 conjugate, 0.1mg/mL
BNC683781-100 1x 100 µL

Calprotectin / MRP14 / S100A9 / Calgranulin B (rMAC3781), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44v3 (Marker of Tumor Metastasis) (3G5), CF405S conjugate, 0.1mg/mL
BNC042429-500 1x 500 µL

CD44v3 (Marker of Tumor Metastasis) (3G5), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Elab Fluor® 488 Rat IgG1, κ Isotype Control[HRPN]
E-AB-F09822L-01 20 Tests

Elab Fluor® 488 Rat IgG1, κ Isotype Control[HRPN]

Sign In for Pricing
View Details
Elab Fluor® 488 Rat IgG1, κ Isotype Control[HRPN]
E-AB-F09822L-02 100 Tests

Elab Fluor® 488 Rat IgG1, κ Isotype Control[HRPN]

Sign In for Pricing
View Details
Elab Fluor® 488 Rat IgG1, κ Isotype Control[HRPN]
E-AB-F09822L-03 2x 100 Tests

Elab Fluor® 488 Rat IgG1, κ Isotype Control[HRPN]

Sign In for Pricing
View Details
Spastin (Sp 3G11-1), CF647 conjugate, 0.1mg/mL
BNC472844-100 1x 100 µL

Spastin (Sp 3G11-1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details