Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ILVBL Peptide - C-terminal region

ILVBL Peptide - C-terminal region

Product Specifications

Product Name Alternative

AHAS, 209L8, ILV2H

UniProt

A1L0T0

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_006835.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VRHKIPVMALVGNDAGWTQISREQVPSLGSNVACGLAYTDYHKAAMGLGA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rubitecan
TRC-R701500-5MG 5 mg

Rubitecan

Sign In for Pricing
View Details
IL17B Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2A3]
TA811136BM 100 µL

IL17B Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2A3]

Sign In for Pricing
View Details
BNIP2 Antibody
8C14696-AAT 50 µg

BNIP2 Antibody

Sign In for Pricing
View Details
Recombinant Human ROR1 Protein (His Tag)
PKSH033647-01 10 µg

Recombinant Human ROR1 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human ROR1 Protein (His Tag)
PKSH033647-02 50 µg

Recombinant Human ROR1 Protein (His Tag)

Sign In for Pricing
View Details
Human FBXO27 activation kit by CRISPRa
GA114948 1 Kit

Human FBXO27 activation kit by CRISPRa

Sign In for Pricing
View Details