Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

WDR70 Peptide - middle region

WDR70 Peptide - middle region

Product Specifications

UniProt

Q9NW82

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_060504.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KQLEKDRLDPLKSHKPEPPVAGPGRGGRVGTHGGTLSSYIVKNIALDKTD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Oxolinic Acid
TRC-O857500-5G 5 g

Oxolinic Acid

Sign In for Pricing
View Details
CD21 (CR2) Mouse Monoclonal Antibody [Clone ID: OTI1G1]
CF814108 100 µg

CD21 (CR2) Mouse Monoclonal Antibody [Clone ID: OTI1G1]

Sign In for Pricing
View Details
Polystyrene AM RAM
H50056023.5G 5 g

Polystyrene AM RAM

Sign In for Pricing
View Details
IL 4 Human
OM296564-01 20 µg

IL 4 Human

Sign In for Pricing
View Details
IL 4 Human
OM296564-02 5 µg

IL 4 Human

Sign In for Pricing
View Details
IL 4 Human
OM296564-03 1 mg

IL 4 Human

Sign In for Pricing
View Details