Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

WDR70 Peptide - middle region

WDR70 Peptide - middle region

Product Specifications

UniProt

Q9NW82

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_060504.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KQLEKDRLDPLKSHKPEPPVAGPGRGGRVGTHGGTLSSYIVKNIALDKTD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MAGT1 (NM_032121) Human Over-expression Lysate
LY432198 100 µg

MAGT1 (NM_032121) Human Over-expression Lysate

Sign In for Pricing
View Details
Propiophenone-d5
TRC-P827902-50MG 50 mg

Propiophenone-d5

Sign In for Pricing
View Details
Solvent Blue 101 (Technical Grade)
TRC-S676760-2.5G 2.5 g

Solvent Blue 101 (Technical Grade)

Sign In for Pricing
View Details
Rat PGF2α (Prostaglandin F2 Alpha) ELISA Kit
E-EL-R0795-01 24 Tests

Rat PGF2α (Prostaglandin F2 Alpha) ELISA Kit

Sign In for Pricing
View Details
Rat PGF2α (Prostaglandin F2 Alpha) ELISA Kit
E-EL-R0795-02 48 Tests

Rat PGF2α (Prostaglandin F2 Alpha) ELISA Kit

Sign In for Pricing
View Details
Rat PGF2α (Prostaglandin F2 Alpha) ELISA Kit
E-EL-R0795-03 96 Tests

Rat PGF2α (Prostaglandin F2 Alpha) ELISA Kit

Sign In for Pricing
View Details