Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OXSM Peptide - middle region

OXSM Peptide - middle region

Product Specifications

Product Name Alternative

KS, KASI, FASN2D

UniProt

Q9NWU1

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001138863.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QRRARIYAEVLGYGLSGDAGHITAPDPEGEGALRCMAAALKDAGVQPEEI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Calcium binding protein P22 (CHP1) Mouse Monoclonal Antibody [Clone ID: OTI2E2]
CF810158 100 µg

Calcium binding protein P22 (CHP1) Mouse Monoclonal Antibody [Clone ID: OTI2E2]

Sign In for Pricing
View Details
Triosephosphate isomerase (TPI1) (NM_000365) Human Recombinant Protein
TP720233XL 1 mg

Triosephosphate isomerase (TPI1) (NM_000365) Human Recombinant Protein

Sign In for Pricing
View Details
INPP5B Rabbit Polyclonal Antibody
TA368548 100 µL

INPP5B Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CD31 / PECAM-1 (C31.3 + C31.7 + C31.10), CF405L conjugate, 0.1mg/mL
BNC061099-500 1x 500 µL

CD31 / PECAM-1 (C31.3 + C31.7 + C31.10), CF405L conjugate, 0.1mg/mL

Sign In for Pricing
View Details
GSK3 beta (GSK3B) (NM_001146156) Human Over-expression Lysate
LY431916 100 µg

GSK3 beta (GSK3B) (NM_001146156) Human Over-expression Lysate

Sign In for Pricing
View Details
DEPP1 Human Gene Knockout Kit (CRISPR)
KN402009 1 Kit

DEPP1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details