Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OXSM Peptide - middle region

OXSM Peptide - middle region

Product Specifications

Product Name Alternative

KS, KASI, FASN2D

UniProt

Q9NWU1

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001138863.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QRRARIYAEVLGYGLSGDAGHITAPDPEGEGALRCMAAALKDAGVQPEEI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HSP60 Mouse Monoclonal Antibody [9-49]
M1007-9 100 µL

HSP60 Mouse Monoclonal Antibody [9-49]

Sign In for Pricing
View Details
Human Thrombospondin 2 (THBS2) ELISA Kit
RDR-THBS2-Hu-01 96 Tests

Human Thrombospondin 2 (THBS2) ELISA Kit

Sign In for Pricing
View Details
Human Thrombospondin 2 (THBS2) ELISA Kit
RDR-THBS2-Hu-02 48 Tests

Human Thrombospondin 2 (THBS2) ELISA Kit

Sign In for Pricing
View Details
Gallocatechin Ethanol Complex
TRC-G188992-1MG 1 mg

Gallocatechin Ethanol Complex

Sign In for Pricing
View Details
Human OR52B6 activation kit by CRISPRa
GA117504 1 Kit

Human OR52B6 activation kit by CRISPRa

Sign In for Pricing
View Details
Porcine Lipopolysaccharide Binding Protein (LBP) ELISA Kit
RDR-LBP-p-01 96 Tests

Porcine Lipopolysaccharide Binding Protein (LBP) ELISA Kit

Sign In for Pricing
View Details