DBNDD2 Peptide - middle region
DBNDD2 Peptide - middle region
Product Specifications
Product Name Alternative
CK1BP, HSMNP1, C20orf35
UniProt
Q9BQY9
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_001041686.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: DPNPRAALERQQLRLRERQKFFEDILQPETEFVFPLSHLHLESQRPPIGS
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
K4431707 1.0 µg DNA
Ptprn2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)
Sign In for Pricing
View Details 
MBS1254728-01 0.02 mg (E-Coli)
Recombinant Campylobacter jejuni subsp.jejuni serotype O:23/36 ATP synthase epsilon chain (atpC)
Sign In for Pricing
View Details MBS1254728-02 0.1 mg (E-Coli)
Recombinant Campylobacter jejuni subsp.jejuni serotype O:23/36 ATP synthase epsilon chain (atpC)
Sign In for Pricing
View Details MBS1254728-03 0.02 mg (Yeast)
Recombinant Campylobacter jejuni subsp.jejuni serotype O:23/36 ATP synthase epsilon chain (atpC)
Sign In for Pricing
View Details MBS1254728-04 0.1 mg (Yeast)
Recombinant Campylobacter jejuni subsp.jejuni serotype O:23/36 ATP synthase epsilon chain (atpC)
Sign In for Pricing
View Details