What is the catalog number for DBNDD2 Peptide - middle region?

The catalog number for DBNDD2 Peptide - middle region is orb1998997.

What sizes are available for DBNDD2 Peptide - middle region?

DBNDD2 Peptide - middle region is available in the following size(s): 100 µg.

Is DBNDD2 Peptide - middle region in stock?

DBNDD2 Peptide - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

DBNDD2 Peptide - middle region

Product Specifications

Product Name Alternative

CK1BP, HSMNP1, C20orf35

UniProt

Q9BQY9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001041686.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DPNPRAALERQQLRLRERQKFFEDILQPETEFVFPLSHLHLESQRPPIGS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HE068058-5K Inquire

Boc-NH-PEG-SVA, 5K

Sign In for Pricing

View Details

WCA67070 2.5 g

2- (Chloromethyl) -5-methylpyridine hydrochloride

Sign In for Pricing

View Details

YP-W71709-01 48 Tests

Porcine Carboxyl peptide B1 (CPB1) ELISA Kit

Sign In for Pricing

View Details

YP-W71709-02 96 Tests

Porcine Carboxyl peptide B1 (CPB1) ELISA Kit

Sign In for Pricing

View Details

24266064 1.0 µg DNA

IFNB1 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing

View Details

MG211933 10 µg

Dhx57 (BC062952) Mouse Tagged ORF Clone

Sign In for Pricing

View Details