Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DNAJC28 Peptide - middle region

DNAJC28 Peptide - middle region

Product Specifications

Product Name Alternative

C21orf55, C21orf78

UniProt

Q9NX36

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001035282.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LVEDLIQESMAKGDFDNLSGKGKPLKKFSDCSYIDPMTHNLNRILIDNGY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HERC5 Antibody
KC-2322-01 50 μL

HERC5 Antibody

Sign In for Pricing
View Details
HERC5 Antibody
KC-2322-02 100 µL

HERC5 Antibody

Sign In for Pricing
View Details
HERC5 Antibody
KC-2322-03 1 mL

HERC5 Antibody

Sign In for Pricing
View Details
Human FAM18B2 (TVP23C) activation kit by CRISPRa
GA116376 1 Kit

Human FAM18B2 (TVP23C) activation kit by CRISPRa

Sign In for Pricing
View Details
Cytokeratin, multi (C11), 1mg/mL
BNUM0393-50 1x 50 µL

Cytokeratin, multi (C11), 1mg/mL

Sign In for Pricing
View Details
ASS1 Mouse Monoclonal Antibody [Clone ID: OTI3D1]
CF809168 100 µg

ASS1 Mouse Monoclonal Antibody [Clone ID: OTI3D1]

Sign In for Pricing
View Details