Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DNAJC28 Peptide - middle region

DNAJC28 Peptide - middle region

Product Specifications

Product Name Alternative

C21orf55, C21orf78

UniProt

Q9NX36

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001035282.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LVEDLIQESMAKGDFDNLSGKGKPLKKFSDCSYIDPMTHNLNRILIDNGY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bromodeoxyuridine / BrDU Mouse Monoclonal Antibody [Clone ID: BRD494]
AM33307PU-S 100 µg

Bromodeoxyuridine / BrDU Mouse Monoclonal Antibody [Clone ID: BRD494]

Sign In for Pricing
View Details
CD79B (NM_000626) Human Over-expression Lysate
LY424598 100 µg

CD79B (NM_000626) Human Over-expression Lysate

Sign In for Pricing
View Details
GFAP Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1B3]
TA500342AM 100 µL

GFAP Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1B3]

Sign In for Pricing
View Details
Coelenterazine 400A (DEEPBLUEC, A TRADEM
#10125 1x 50 µg

Coelenterazine 400A (DEEPBLUEC, A TRADEM

Sign In for Pricing
View Details
Catenin-δ1 (Ab-228) Antibody
8B0891-AAT 50 µg

Catenin-δ1 (Ab-228) Antibody

Sign In for Pricing
View Details
Citric Acid
TRC-C521000-1G 1 g

Citric Acid

Sign In for Pricing
View Details