Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UBXN6 Peptide - middle region

UBXN6 Peptide - middle region

Product Specifications

Product Name Alternative

UBXD1, UBXDC2

UniProt

Q9BZV1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001164562.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ILLHFSTDPVAASIMKIYTFNKDQDRVKLGVDTIAKYLDNIHLHPEEEKY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD14 (Monocyte / Macrophage Marker) (LPSR/2385), CF405S conjugate, 0.1mg/mL
BNC042385-100 1x 100 µL

CD14 (Monocyte / Macrophage Marker) (LPSR/2385), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human KCNK16 activation kit by CRISPRa
GA113268 1 Kit

Human KCNK16 activation kit by CRISPRa

Sign In for Pricing
View Details
n-Octylbenzene
TRC-O272850-25G 25 g

n-Octylbenzene

Sign In for Pricing
View Details
SRGAP2 (NM_015326) Human Recombinant Protein
TP324139L 1 mg

SRGAP2 (NM_015326) Human Recombinant Protein

Sign In for Pricing
View Details
PCR Strip Tubes
P3010-A-O 120 Units/Pack

PCR Strip Tubes

Sign In for Pricing
View Details
Pipette Rack
P4405 1 Each

Pipette Rack

Sign In for Pricing
View Details