Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UBXN6 Peptide - middle region

UBXN6 Peptide - middle region

Product Specifications

Product Name Alternative

UBXD1, UBXDC2

UniProt

Q9BZV1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001164562.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ILLHFSTDPVAASIMKIYTFNKDQDRVKLGVDTIAKYLDNIHLHPEEEKY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Diphenoxylate Hydrochloride
TRC-D489400-5MG 5 mg

Diphenoxylate Hydrochloride

Sign In for Pricing
View Details
Elab Fluor® 700 Anti-Human CD39 Antibody[A1]
E-AB-F1165M1-01 20 Tests

Elab Fluor® 700 Anti-Human CD39 Antibody[A1]

Sign In for Pricing
View Details
Elab Fluor® 700 Anti-Human CD39 Antibody[A1]
E-AB-F1165M1-02 100 Tests

Elab Fluor® 700 Anti-Human CD39 Antibody[A1]

Sign In for Pricing
View Details
Elab Fluor® 700 Anti-Human CD39 Antibody[A1]
E-AB-F1165M1-03 2x 100 Tests

Elab Fluor® 700 Anti-Human CD39 Antibody[A1]

Sign In for Pricing
View Details
CDX2 Antibody
KC-152-01 50 μL

CDX2 Antibody

Sign In for Pricing
View Details
CDX2 Antibody
KC-152-02 100 µL

CDX2 Antibody

Sign In for Pricing
View Details