Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EIF3B Peptide - middle region

EIF3B Peptide - middle region

Product Specifications

Product Name Alternative

PRT1, EIF3S9, EIF3-ETA, EIF3-P110, EIF3-P116

UniProt

P55884

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001032360.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ENGDADEPSFSDPEDFVDDVSEEELLGDVLKDRPQEADGIDSVIVVDNVP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AdmiRa-hsa-miR-651-3p Virus
mh2282 250 µL

AdmiRa-hsa-miR-651-3p Virus

Sign In for Pricing
View Details
LHFPL5 Human Over-expression Lysate
orb1354714 100 µg

LHFPL5 Human Over-expression Lysate

Sign In for Pricing
View Details
SLC36A4
CSB-CL761571HU 10 μg Plasmid + 200 μL Glycerol

SLC36A4

Sign In for Pricing
View Details
Mycobacterium tuberculosis, 38kD (FITC) discontinued
M9699-74B-FITC 100 µL

Mycobacterium tuberculosis, 38kD (FITC) discontinued

Sign In for Pricing
View Details
Rabbit ARIP4 IHC Antibody
orb1517954-01 10 µL

Rabbit ARIP4 IHC Antibody

Sign In for Pricing
View Details
Rabbit ARIP4 IHC Antibody
orb1517954-02 100 µL

Rabbit ARIP4 IHC Antibody

Sign In for Pricing
View Details