Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EIF3B Peptide - C-terminal region

EIF3B Peptide - C-terminal region

Product Specifications

Product Name Alternative

PRT1, EIF3S9, EIF3-ETA, EIF3-P110, EIF3-P116

UniProt

P55884

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001032360.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RRRTMMEDFRKYRKMAQELYMEQKNERLELRGGVDTDELDSNVDDWEEET

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

1- (2-Methoxyethyl) -1-methylpyrrolidinium bis (trifluoromethylsulfonyl) imide
IL-0359-HP-0100 100 g

1- (2-Methoxyethyl) -1-methylpyrrolidinium bis (trifluoromethylsulfonyl) imide

Sign In for Pricing
View Details
RNF121 Rabbit Polyclonal Antibody
orb578850 100 µL

RNF121 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
HIV-2 Envelope Protein
orb426193-01 100 µg

HIV-2 Envelope Protein

Sign In for Pricing
View Details
HIV-2 Envelope Protein
orb426193-02 0.5 mg

HIV-2 Envelope Protein

Sign In for Pricing
View Details
HIV-2 Envelope Protein
orb426193-03 1 mg

HIV-2 Envelope Protein

Sign In for Pricing
View Details
Dog/Canine Calprotectin CP ELISA Kit
orb1176674 1x 96 Tests

Dog/Canine Calprotectin CP ELISA Kit

Sign In for Pricing
View Details