EIF3B Peptide - C-terminal region
EIF3B Peptide - C-terminal region
Product Specifications
Product Name Alternative
PRT1, EIF3S9, EIF3-ETA, EIF3-P110, EIF3-P116
UniProt
P55884
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_001032360.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: RRRTMMEDFRKYRKMAQELYMEQKNERLELRGGVDTDELDSNVDDWEEET
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
T9160-13C 500 µg
Tumor Necrosis Factor, alpha (TNFa, TNFSF2) discontinued
Sign In for Pricing
View Details NBP2-46259 0.1 mL
Mouse monoclonal 5'-Nucleotidase/CD73 Antibody (OTI1G2)
Sign In for Pricing
View Details 
orb3007283-01 20 µg
Recombinant Human Proton-coupled zinc antiporter SLC30A1 (ZNT1), partial
Sign In for Pricing
View Details orb3007283-02 100 µg
Recombinant Human Proton-coupled zinc antiporter SLC30A1 (ZNT1), partial
Sign In for Pricing
View Details orb3007283-03 1 mg
Recombinant Human Proton-coupled zinc antiporter SLC30A1 (ZNT1), partial
Sign In for Pricing
View Details