Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TIAL1 Peptide - middle region

TIAL1 Peptide - middle region

Product Specifications

Product Name Alternative

TCBP, TIAR

UniProt

P31483

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001029097.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EFYEHRDAAAALAAMNGRKILGKEVKVNWATTPSSQKKDTSNHFHVFVGD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Necap2 sgRNA CRISPR Lentivector set (Mouse)
K4500201 3x 1.0 µg

Necap2 sgRNA CRISPR Lentivector set (Mouse)

Sign In for Pricing
View Details
Dynactin subunit 4 (DCTN4) Mouse ELISA Kit
D0335 96 Tests

Dynactin subunit 4 (DCTN4) Mouse ELISA Kit

Sign In for Pricing
View Details
Zfp672 sgRNA CRISPR Lentivector (Mouse) (Target 2)
K4577203 1.0 µg DNA

Zfp672 sgRNA CRISPR Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
VIT (NM_001177970) Human Tagged Lenti ORF Clone
RC230400L4 10 µg

VIT (NM_001177970) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Recombinant Aeropyrum pernix Putative ribonuclease VapC3 (vapC3)
MBS1284308-01 0.02 mg (E-Coli)

Recombinant Aeropyrum pernix Putative ribonuclease VapC3 (vapC3)

Sign In for Pricing
View Details
Recombinant Aeropyrum pernix Putative ribonuclease VapC3 (vapC3)
MBS1284308-02 0.1 mg (E-Coli)

Recombinant Aeropyrum pernix Putative ribonuclease VapC3 (vapC3)

Sign In for Pricing
View Details